omics.co.in logo omics.co.in

Chapter 7: Protein Complex Modeling & AlphaFold-Multimer

1 min read • Verified October 2026 • Peer-Reviewed Learning Resource
Tested Stacks: GATK 4.6.1 Samtools 1.21 Nextflow 24.10 Seurat v5.1 Python 3.12
Prerequisites: Basic Linux CLI & Sequencing Formats
📚 Chapter 7 of 13 0% Course Completed

Chapter 7: Protein Complex Modeling & AlphaFold-Multimer

Most biological functions are executed not by isolated monomeric proteins, but by multi-protein quaternary complexes (dimers, trimers, large macromolecular assemblies). AlphaFold-Multimer extends the AlphaFold architecture to predict multi-chain complexes and protein-protein interactions (PPIs).

The Challenge of Cross-Chain MSA Pairing

In multimer prediction, how does the model know which organism sequence in Chain A's MSA corresponds to which sequence in Chain B's MSA? AlphaFold-Multimer solves this by matching UniProt taxonomic IDs and genetic operon locus distances to pair interacting orthologs.

1. The Interface pTM (ipTM) Metric

In addition to global TM-score, AlphaFold-Multimer computes ipTM (interface predicted Template Modeling score), evaluating confidence specifically at the binding interface between chains:

# Multimer Model Scoring Metric:
# Model Score = 0.8 * ipTM + 0.2 * pTM
#
# ipTM > 0.85: Extremely confident binding interface; highly reliable complex model
# ipTM 0.6 - 0.85: Confident interface fold; exact side-chain contact poses may vary
# ipTM < 0.6: Unconfident interface; likely non-interacting transient proteins or false binding

2. Predicting Complexes with ColabFold Multimer

# Fast multimer prediction by separating FASTA sequences with a colon ':'
cat << 'FASTA_EOF' > complex.fasta
>CDK2_CyclinA
MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRL:MRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVPR
FASTA_EOF

colabfold_batch complex.fasta ./colabfold_multimer_out/ --model-type alphafold2_multimer_v3
⚠️

Common Pitfalls & Troubleshooting Checklist

  • Java Heap Exhaustion (GATK / Picard): If processes terminate with java.lang.OutOfMemoryError, set your environment variable explicitly: export _JAVA_OPTIONS="-Xmx16g -Djava.io.tmpdir=/tmp".
  • Index Timestamp Mismatch: If tools complain that a BAM index is missing or out of date, regenerate with samtools index -@ 4 sample.bam.
  • Conda Channel Conflicts: Avoid ABI incompatibilities between bioconda and conda-forge by setting strict priority: conda config --set channel_priority strict.
  • Chromosome Naming Contamination: Always verify whether reference FASTA headers use chr1 or 1; divergent naming causes silent alignment drops.
Was this guide helpful to your research?
Help us maintain 100% accurate, peer-reviewed bioinformatics standards.
📝 Propose Edit on GitHub ↗